EDAR : Dog

Arrow UniprotKB ID: E2R2Q1
Arrow Length: 480
Arrow Format: fasta embl genbank
>E2R2Q1 Uncharacterized protein OS=Canis familiaris GN=EDAR PE=4 SV=1
MAHTGDRKRMPWLPVLVVSLLCSARAEYSNCGENEYYNQTTGLCHECPQCGPGEEPYLSCGYGTKDEDYG
CVPCPAEKFSKGGYQICRRHKDCEGFFRATVLTPGDMENDAECGPCLPGYYMLENRPRNIYGMVCYSCLL
APPNTKECAGASSGASANFPSTSGSSTLSPFQHAHKAELSGQGHLATALIIAMSTIFIMAIAIVLIIMFY
IMKTKPSAPGDCSPMPLLPPHRPLLPDSSVSLPSLLPFLQPACCTSHPVKSVEAQVSKEEEKKEPQDSVV
IFSEKDEFEKLTTAPAKTAKSENDASSENEQLLSRSMDSDEEPATDKQGSPELCLLSLVHLAREKPAATK
SAGIQSRRKKILDVYANVCGVVEGLSPTELPFDCLEKTSRMLSSTYNSEKAVVKTWRHLAESFGLKRDEI
GGMTDGLQLFDRISTAGYSIPELLTKLVQIERLDAVESLCADILEWAGLVPPASQPPATS

(source: UniprotKBExternal)