IRAK2 : Rat

Arrow UniprotKB ID: Q4QQS0
Arrow Length: 624
Arrow Format: fasta embl genbank
>Q4QQS0 Interleukin-1 receptor-associated kinase-like 2 OS=Rattus norvegicus GN=Irak2 PE=2 SV=1
MACYIYQLPSWVLDDLCRNIDTLSEWDWMQFASYVITDLTQLRKIKSMERVQGVSITRELLWWWSMRQAT
VQQLVDLLCHLELYRAAQIVLSWKPAPDSLSPLSAFPEAVKPGPVATSGRNLKDDQKKGQPVKPCSFLSS
GTTMAGAQQQASCQRPCEEDAPCSLKTDVPDSLQSKYCSTSIPKQEKLLNLPGDRLFWSEADIVQATEDF
DQSHRISEGTFADIYRGQRNGVAFAFKRLREVTGSSPGSMDRFLQAEMQLCLRCCHPNILPLLGFCTGRQ
FHSLIYPYMANGSLQDRLWAQGDSDMLSWPQRASICSGLLLAVEHLHSLDIIHSNVKSANVLLDQHLNPK
LAHPVAHPCPTNKKTKYTVMKTHLFQASAAYLPENFIRVGQLTKQVDIFSCGIVLAEVLTGIPAMDKDRS
PVYLKDLLLSEIPSNTSSVHSRKTSMGKVVVKEICQKHLERKAGLLPEACAETWATAVSVCLRRREASLE
EARVSMAGVEEQLRGQLSLPWSRVSEDTGSSSNTPEETDDVDNSSLSVPSSVMVVSCARVSSPPPSMGNG
TAQPSTSGRQEADSSSEACAGPQPPQEATETSWKIEINEAKRRLMENILLYKEEKLDSVELFGP

(source: UniprotKBExternal)